RetrogeneDB ID: | retro_mmus_3582 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | X:18155285..18155457(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Myeov2 | ||
| Ensembl ID: | ENSMUSG00000073616 | ||
| Aliases: | Myeov2, 1110002M09Rik | ||
| Description: | myeloma overexpressed 2 [Source:MGI Symbol;Acc:MGI:1914165] |
| Percent Identity: | 86.21 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | MKPAVDEMFPEGAGPYVDLDEAGGSTGLLMDLAANEKAVHAD-FFNDFEDLFDDDDVQ |
| M..AV.EMF.EGAGPYVDLDEAGGS.GLLMDLAANEKAVHA..F.NDFEDLFDDDDVQ | |
| Retrocopy | MELAVNEMFSEGAGPYVDLDEAGGSSGLLMDLAANEKAVHAE>FKNDFEDLFDDDDVQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 31 .47 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 28 .66 RPM |
| SRP007412_heart | 0 .00 RPM | 25 .65 RPM |
| SRP007412_kidney | 0 .00 RPM | 34 .76 RPM |
| SRP007412_liver | 0 .00 RPM | 18 .84 RPM |
| SRP007412_testis | 0 .00 RPM | 41 .99 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Homo sapiens | ENSG00000172428 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000011336 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000013501 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000073616 | 1 retrocopy |
retro_mmus_3582 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000000776 | 1 retrocopy |