RetrogeneDB ID: | retro_itri_718 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393313.1:13241376..13241546(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSSTOG00000024985 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MYEOV2 | ||
| Ensembl ID: | ENSSTOG00000000776 | ||
| Aliases: | None | ||
| Description: | myeloma overexpressed 2 [Source:HGNC Symbol;Acc:21314] |
| Percent Identity: | 98.28 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | MKPAVDEMF-PEGAGPYVDLDEAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDVQ |
| MKPAVDEMF.PEGAGPYVDLDEAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDVQ | |
| Retrocopy | MKPAVDEMF<PEGAGPYVDLDEAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDVQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Homo sapiens | ENSG00000172428 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000011336 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000013501 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000073616 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000000776 | 1 retrocopy |
retro_itri_718 ,
|