RetrogeneDB ID: | retro_mmus_2436 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 4:15531673..15532117(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSMUSG00000083330 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Rbm7 | ||
| Ensembl ID: | ENSMUSG00000042396 | ||
| Aliases: | Rbm7, 1200007M24Rik, 1500011D06Rik, AU041934, AW554393 | ||
| Description: | RNA binding motif protein 7 [Source:MGI Symbol;Acc:MGI:1914260] |
| Percent Identity: | 52.56 % |
| Parental protein coverage: | 56.98 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 5 |
| Parental | AAEADRTLFVG-NLETKVTEELLFELFHQAGPVIK-VKIPKDKDGKLKQFAFVNFKHEVSVPYAMNLLNG |
| ..EAD..L..G..LE..V.EE.LFE.FH...P..K.VKIPKDK....KQFAF.NFK........M.LL.. | |
| Retrocopy | STEADCSLVIG<HLELWVMEEILFEIFHWTRPFQK>VKIPKDKNSEPKQFAFLNFKCKLFTAFVMDLLTR |
| Parental | IKLFGRPIKIQF-RSGSSHASQDASVSYP-QHHVGNLSPTSTSPNSYERTVGNVSPTAQMVQRSFSSPED |
| ..L.GRP.K....RSG.SHASQD.SV.YP.QHH.GN..P...S..S..RTV.N.....Q..QR..SS.E. | |
| Retrocopy | PRLLGRP-KLRL<RSGNSHASQDDSV*YP<QHHFGNSDPIYASSTS-QRTVENMTVSLQIIQRLSSSAEN |
| Parental | YQRQ-AVMNSVFRQMS |
| YQRQ.AV.N.V..QMS | |
| Retrocopy | YQRQ<AVINNVLSQMS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 18 .76 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 17 .28 RPM |
| SRP007412_heart | 0 .00 RPM | 12 .20 RPM |
| SRP007412_kidney | 0 .02 RPM | 24 .83 RPM |
| SRP007412_liver | 0 .00 RPM | 31 .40 RPM |
| SRP007412_testis | 0 .00 RPM | 47 .16 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000013514 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000012747 | 1 retrocopy | |
| Homo sapiens | ENSG00000076053 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000009941 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000012444 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000023234 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000013918 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000042396 | 1 retrocopy |
retro_mmus_2436 ,
|
| Mus musculus | ENSMUSG00000068856 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000007323 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000003342 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000016857 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000003894 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000004305 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000012459 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000001515 | 3 retrocopies | |
| Vicugna pacos | ENSVPAG00000006300 | 1 retrocopy |