RetrogeneDB ID: | retro_ggor_1696 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 2a:81611081..81611482(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSGGOG00000023594 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ENSG00000076053 | ||
| Ensembl ID: | ENSGGOG00000009941 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 97.04 % |
| Parental protein coverage: | 91.78 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | FVGNLETKVTEELLFELFHQAGPVIKVK-IPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGIKLYGRPIK |
| FVGNLETKVTEELLFELFHQAGPVIKVK.IPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGIKLYGRPIK | |
| Retrocopy | FVGNLETKVTEELLFELFHQAGPVIKVK<IPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGIKLYGRPIK |
| Parental | IQFRSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSRYERTMDNMTSSAQIIQRSFSSPENFQRQAV |
| IQFRSGSSHA.QDVSL.YPQHHVGNSSPTSTSPSRYERT.DNMTSSAQIIQRSFSSPENFQRQAV | |
| Retrocopy | IQFRSGSSHASQDVSLPYPQHHVGNSSPTSTSPSRYERTRDNMTSSAQIIQRSFSSPENFQRQAV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 0 .91 RPM |
| SRP007412_cerebellum | 0 .24 RPM | 1 .34 RPM |
| SRP007412_heart | 0 .16 RPM | 0 .72 RPM |
| SRP007412_kidney | 0 .49 RPM | 1 .80 RPM |
| SRP007412_liver | 0 .42 RPM | 2 .48 RPM |
| SRP007412_testis | 1 .35 RPM | 8 .29 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2283 |
| Pan troglodytes | retro_ptro_1617 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000013514 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000012747 | 1 retrocopy | |
| Homo sapiens | ENSG00000076053 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000004761 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000009941 | 1 retrocopy |
retro_ggor_1696 ,
|
| Loxodonta africana | ENSLAFG00000012444 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000023234 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000013918 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000042396 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000007323 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000003342 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000016857 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000003894 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000004305 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000012459 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000001515 | 3 retrocopies | |
| Vicugna pacos | ENSVPAG00000006300 | 1 retrocopy |