RetrogeneDB ID: | retro_mmus_2105 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 2:150378880..150379272(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSMUSG00000083077 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Snrnp27 | ||
| Ensembl ID: | ENSMUSG00000001158 | ||
| Aliases: | Snrnp27, 2610209M04Rik, AI449063, AU022368, Ry1 | ||
| Description: | small nuclear ribonucleoprotein 27 (U4/U6.U5) [Source:MGI Symbol;Acc:MGI:1913868] |
| Percent Identity: | 66.91 % |
| Parental protein coverage: | 87.1 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | RDRERRRRERSRSRERDRRRSRS-RSPHRRRSRSPRRHRSTSPSPSRLKERRDEEKKETKEIKNKERQIT |
| R.RERR..E..R.RER.R.RS.S..S.H.R.SRSP..HRSTSPSPSRLK..................QIT | |
| Retrocopy | RERERRCPESFRFRERER-RSCS<KSSH*RCSRSPG*HRSTSPSPSRLKXXXXXXXXXXXXXXXXXYQIT |
| Parental | EEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNRPLDFIA |
| .ED.EGKTEEE...MKLMGFASFDSTKGKK.D.SVNAYAINVSQKRKYRQ.MNRK..FNR.LDFIA | |
| Retrocopy | GEDQEGKTEEE---MKLMGFASFDSTKGKKSDNSVNAYAINVSQKRKYRQFMNRKDRFNRHLDFIA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .02 RPM | 16 .21 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 20 .93 RPM |
| SRP007412_heart | 0 .00 RPM | 15 .44 RPM |
| SRP007412_kidney | 0 .00 RPM | 18 .88 RPM |
| SRP007412_liver | 0 .00 RPM | 7 .59 RPM |
| SRP007412_testis | 0 .00 RPM | 21 .18 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000037746 | 4 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000003042 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000017344 | 1 retrocopy | |
| Homo sapiens | ENSG00000124380 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000001158 | 2 retrocopies |
retro_mmus_1977, retro_mmus_2105 ,
|
| Oryctolagus cuniculus | ENSOCUG00000022967 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012332 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000012022 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000025674 | 1 retrocopy |