RetrogeneDB ID: | retro_mmus_2012 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 2:18249457..18249843(-) | ||
| Located in intron of: | ENSMUSG00000026740 | ||
Retrocopyinformation | Ensembl ID: | ENSMUSG00000083070 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Gar1 | ||
| Ensembl ID: | ENSMUSG00000028010 | ||
| Aliases: | Gar1, AA409823, AI326794, C430047J18Rik, Nola1 | ||
| Description: | GAR1 ribonucleoprotein homolog (yeast) [Source:MGI Symbol;Acc:MGI:1930948] |
| Percent Identity: | 85.38 % |
| Parental protein coverage: | 55.84 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | GRGGGRGGFNKFQDQGPPERVVLLGEFMHPCEDDIVCKCTTEENKVPYFNAPVYLENKEQVGKVDEIFGQ |
| G.GGGRGGFNKFQDQGPPE.VVL.GEFMH.CEDDI.CKCTTE.N.VPYFNAPVYLENKEQ..KVD..FGQ | |
| Retrocopy | G*GGGRGGFNKFQDQGPPEHVVLFGEFMHLCEDDIICKCTTEGNTVPYFNAPVYLENKEQIRKVDGMFGQ |
| Parental | LRDFYFSVKLSENMKASSFKKLQKFYI-DPYKLLPLQRFLPRPPGEKGPPRGGGGGGRGG |
| LRDFYFSVKLS.NMK.SSFKKLQKFYI..PYKLLPLQRFLPR..GEKGPPRGG.GG.RGG | |
| Retrocopy | LRDFYFSVKLSKNMKVSSFKKLQKFYI<NPYKLLPLQRFLPRHTGEKGPPRGGSGGSRGG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .02 RPM | 9 .63 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 12 .94 RPM |
| SRP007412_heart | 0 .00 RPM | 9 .09 RPM |
| SRP007412_kidney | 0 .00 RPM | 13 .38 RPM |
| SRP007412_liver | 0 .03 RPM | 8 .30 RPM |
| SRP007412_testis | 0 .00 RPM | 33 .48 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000004605 | 2 retrocopies | |
| Homo sapiens | ENSG00000109534 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000008681 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000003776 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000021225 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000008615 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000028010 | 1 retrocopy |
retro_mmus_2012 ,
|
| Nomascus leucogenys | ENSNLEG00000016578 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000003901 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000004693 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000012089 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000014996 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000016364 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000013668 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000016318 | 1 retrocopy |