RetrogeneDB ID: | retro_mmul_943 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 12:35613570..35613905(-) | ||
| Located in intron of: | ENSMMUG00000007313 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PDAP1 | ||
| Ensembl ID: | ENSMMUG00000001460 | ||
| Aliases: | None | ||
| Description: | 28 kDa heat- and acid-stable phosphoprotein [Source:RefSeq peptide;Acc:NP_001253212] |
| Percent Identity: | 57.39 % |
| Parental protein coverage: | 61.33 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | MPKGGRKGGHKGRARQYTSPE-EIDAQLQAEKQKAREEEEQKESGDGAAGDPKKEKKSLDSDE--SEDEE |
| .PKG.RKGGHK..ARQY..P...I...LQ.EKQKARE.....E....AA..PKK.KKSL.S.....E.E. | |
| Retrocopy | VPKGRRKGGHKS*ARQYIIPQ>QINVHLQVEKQKARE-DTRREWRMEAASNPKK-KKSLASGKRLPENED |
| Parental | D-DYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRRE |
| D.D.QQK.KG.E.LID..NPN.V.Q.T.KVTQL.L..PKE.SR.E | |
| Retrocopy | D>DCQQKYKGIEQLIDMKNPNWVPQITRKVTQLNLGRPKEISRKE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 1 .46 RPM | 50 .98 RPM |
| SRP007412_brain_prefrontal_cortex | 1 .67 RPM | 85 .28 RPM |
| SRP007412_cerebellum | 0 .84 RPM | 38 .87 RPM |
| SRP007412_heart | 0 .24 RPM | 61 .77 RPM |
| SRP007412_kidney | 0 .23 RPM | 41 .78 RPM |
| SRP007412_liver | 0 .04 RPM | 37 .45 RPM |
| SRP007412_testis | 0 .04 RPM | 83 .83 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Gorilla gorilla | retro_ggor_1778 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000015838 | 2 retrocopies | |
| Equus caballus | ENSECAG00000024426 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000009926 | 1 retrocopy | |
| Felis catus | ENSFCAG00000015067 | 1 retrocopy | |
| Homo sapiens | ENSG00000106244 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025196 | 5 retrocopies | |
| Macaca mulatta | ENSMMUG00000001460 | 2 retrocopies |
retro_mmul_1865, retro_mmul_943 ,
|
| Mus musculus | ENSMUSG00000029623 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011017 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000010874 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000013615 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000017375 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000041711 | 4 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000001679 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000010152 | 5 retrocopies | |
| Tursiops truncatus | ENSTTRG00000003004 | 1 retrocopy |