RetrogeneDB ID: | retro_ecab_449 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
| Coordinates: | 18:51153754..51154079(-) | ||
| Located in intron of: | ENSECAG00000011218 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PDAP1 | ||
| Ensembl ID: | ENSECAG00000024426 | ||
| Aliases: | None | ||
| Description: | PDGFA associated protein 1 [Source:HGNC Symbol;Acc:14634] |
| Percent Identity: | 62.5 % |
| Parental protein coverage: | 58.15 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 2 |
| Parental | KGVEGLIDIENPNRVAQTTKKVTQLDLDGP-KELSRREREEIEKQKAKERYMKMHLAGKTEQAKAD-LAR |
| KG.E.LI.IENP..VA.T..KV.QLDLD.P.KEL.R......EK.K..E..MK.HLAGKTEQAKA..LAR | |
| Retrocopy | KGIEELINIENPKWVAETIRKVIQLDLDRP<KEL*RKKQDDTEKRK-QEHFMKIHLAGKTEQAKAI<LAR |
| Parental | LAIIRK---QREEAARKKEEERKAKDDATLSGKRMQSLSLNK |
| ...IRK......EAARKK.EERKAK.DATLSG..MQ.L.LN. | |
| Retrocopy | VTVIRK*QQEGQEAARKKKEERKAKGDATLSGNLMQLLTLNR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .06 RPM | 24 .14 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 38 .59 RPM |
| SRP021940_embryo | 0 .00 RPM | 56 .87 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 30 .94 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 29 .24 RPM |
| SRP021940_testis | 0 .00 RPM | 47 .45 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000015838 | 2 retrocopies | |
| Equus caballus | ENSECAG00000024426 | 1 retrocopy |
retro_ecab_449 ,
|
| Echinops telfairi | ENSETEG00000009926 | 1 retrocopy | |
| Felis catus | ENSFCAG00000015067 | 1 retrocopy | |
| Homo sapiens | ENSG00000106244 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025196 | 5 retrocopies | |
| Macaca mulatta | ENSMMUG00000001460 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000029623 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011017 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000010874 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000013615 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000017375 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000041711 | 4 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000001679 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000010152 | 5 retrocopies | |
| Tursiops truncatus | ENSTTRG00000003004 | 1 retrocopy |