RetrogeneDB ID: | retro_mmul_490 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 1:49591773..49592113(-) | ||
| Located in intron of: | ENSMMUG00000004863 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NENF | ||
| Ensembl ID: | ENSMMUG00000002142 | ||
| Aliases: | None | ||
| Description: | neudesin neurotrophic factor [Source:HGNC Symbol;Acc:30384] |
| Percent Identity: | 69.23 % |
| Parental protein coverage: | 66.28 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 3 |
| Parental | EEDQPIYLAVKGVVFDVTSGKEFYGR-GAPYNALT-GKDSTRGVAKMSLDPADLTHDTTGLTAKELEALD |
| EE.QPIY..VK.VVF.VTS.KEFYGR.GA.YNALT.GK.STRG.AKMSL.P.DLT..T.GL.AKELE.L. | |
| Retrocopy | EEKQPIYMTVKAVVFYVTSRKEFYGR>GATYNALT>GK-STRGIAKMSLGPTDLTYETLGLMAKELESLN |
| Parental | EVFTKVYKAKYPIVGYTARRILNEDGS-PNLDFKPEDQPHFDIKDEF |
| ..FT.VYK.KYP.V.YTA.RILN.D...P.L.FKPED..HFDIK..F | |
| Retrocopy | DIFTTVYKTKYPMVSYTA*RILNRDST<PSLHFKPEDHLHFDIKNVF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 12 .77 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 19 .28 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 8 .01 RPM |
| SRP007412_heart | 0 .00 RPM | 27 .68 RPM |
| SRP007412_kidney | 0 .00 RPM | 43 .78 RPM |
| SRP007412_liver | 0 .00 RPM | 24 .30 RPM |
| SRP007412_testis | 0 .04 RPM | 9 .08 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_379 |
| Pan troglodytes | retro_ptro_295 |
| Pongo abelii | retro_pabe_328 |
| Bos taurus | retro_btau_1238 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001341 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000000759 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000003399 | 1 retrocopy | |
| Felis catus | ENSFCAG00000031796 | 1 retrocopy | |
| Homo sapiens | ENSG00000117691 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025197 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000002142 | 2 retrocopies |
retro_mmul_2064, retro_mmul_490 ,
|
| Mus musculus | ENSMUSG00000037499 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000002893 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000014204 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000000236 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000001961 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000015597 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000022293 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000001880 | 3 retrocopies |