RetrogeneDB ID: | retro_dnov_1256 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_1705:175376..175686(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NENF | ||
| Ensembl ID: | ENSDNOG00000003399 | ||
| Aliases: | None | ||
| Description: | neudesin neurotrophic factor [Source:HGNC Symbol;Acc:30384] |
| Percent Identity: | 66.98 % |
| Parental protein coverage: | 92.04 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | IYMAVKGVVF-DVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLHPADLTHDTTGLTADELQSLDDVFTKV |
| IY.AVK.VV..DVTSGKE.Y.RG..YNAL..KDS.RGV.KMSL.PADLT.D.T.L....L.S.DDV...V | |
| Retrocopy | IYRAVKEVVM<DVTSGKETYRRGPSYNALILKDSSRGVPKMSLFPADLTCDSTSLRGKALMSPDDVLANV |
| Parental | YKAKYPIVGYTAR-RILNEDGSPNLDFKPEDQPHFD |
| YKA.YPI.GYTA..RIL..DG.PNLD.KP.DQ.HFD | |
| Retrocopy | YKANYPIIGYTAE<RILYQDGRPNLDSKPKDQSHFD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 17 .11 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 53 .06 RPM |
| SRP012922_heart | 0 .00 RPM | 20 .19 RPM |
| SRP012922_kidney | 0 .00 RPM | 93 .91 RPM |
| SRP012922_liver | 0 .00 RPM | 30 .03 RPM |
| SRP012922_lung | 0 .00 RPM | 56 .66 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 32 .89 RPM |
| SRP012922_spleen | 0 .00 RPM | 32 .16 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001341 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000000759 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000003399 | 1 retrocopy |
retro_dnov_1256 ,
|
| Felis catus | ENSFCAG00000031796 | 1 retrocopy | |
| Homo sapiens | ENSG00000117691 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025197 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000002142 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000037499 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000002893 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000014204 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000000236 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000001961 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000015597 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000022293 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000001880 | 3 retrocopies |