RetrogeneDB ID: | retro_mmul_458 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 1:213475435..213475701(+) | ||
| Located in intron of: | ENSMMUG00000019995 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | FABP7 | ||
| Ensembl ID: | ENSMMUG00000021907 | ||
| Aliases: | None | ||
| Description: | fatty acid-binding protein, brain [Source:RefSeq peptide;Acc:NP_001244643] |
| Percent Identity: | 71.11 % |
| Parental protein coverage: | 67.42 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | SQEGDKVVIRTLSTFKNTEISFHLGEEFDETTADDRNCKSVVSLDGDKLVHVQKWDGKETNFVREIKDGK |
| S....KVVIR..S.FKNTE.SFHLGEEFD.TT.DDRNCK.VVSLD.DKL.H.QKWD.KET.F.RE.K.G. | |
| Retrocopy | SRRRQKVVIRIRSMFKNTEVSFHLGEEFDKTTTDDRNCKFVVSLDRDKLIHIQKWDDKETYFIREVKYGE |
| Parental | MVMT-LTFGDVVAVRHYEKA |
| MVMT.LTFGD.V...HY.KA | |
| Retrocopy | MVMT<LTFGDDVVAVHYKKA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .11 RPM | 31 .71 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .24 RPM | 27 .29 RPM |
| SRP007412_cerebellum | 0 .06 RPM | 113 .91 RPM |
| SRP007412_heart | 0 .18 RPM | 0 .24 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .12 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .08 RPM | 0 .04 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_536 |
| Pan troglodytes | retro_ptro_402 |
| Gorilla gorilla | retro_ggor_489 |
| Pongo abelii | retro_pabe_213 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000014056 | 1 retrocopy | |
| Homo sapiens | ENSG00000164434 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000025475 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000000486 | 4 retrocopies | |
| Macaca mulatta | ENSMMUG00000002295 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010906 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000019337 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000021907 | 1 retrocopy |
retro_mmul_458 ,
|
| Oryctolagus cuniculus | ENSOCUG00000001497 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000031110 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000000992 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000016979 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000018564 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000003313 | 1 retrocopy |