RetrogeneDB ID: | retro_mmul_1880 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 5:55588372..55588798(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CCDC90B | ||
| Ensembl ID: | ENSMMUG00000020154 | ||
| Aliases: | None | ||
| Description: | coiled-coil domain-containing protein 90B, mitochondrial [Source:RefSeq peptide;Acc:NP_001247740] |
| Percent Identity: | 80.99 % |
| Parental protein coverage: | 55.91 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 0 |
| Parental | QQLMAHLDSIRKDMVILEKSEFANLRAENEKMKIELDQVKQQLMHETSRIRADNKLDINLERSRVTDMFT |
| Q..MAHL.SIRK.M.ILEKSEF.NLRAENEKMK.ELDQVKQQ..HETS.IRADNK.DINLERS.VTDMFT | |
| Retrocopy | QEPMAHLGSIRKEMGILEKSEFTNLRAENEKMKTELDQVKQQSIHETS*IRADNKMDINLERSGVTDMFT |
| Parental | DQEKQLMETTTEFTKKDTQTKSIISETSNKIDAEIASLKTLMESNKLETIRYLAASVFTCLAIALGFYRF |
| D.EKQL.E.TTEFTK.D.QTKSIIS.TSNK.DAEIASLKTLMESNKLET..YLA..VF.CLA.ALGF.RF | |
| Retrocopy | D*EKQLKEATTEFTKTDPQTKSIISVTSNKTDAEIASLKTLMESNKLETVPYLAVLVFNCLAVALGF*RF |
| Parental | WK |
| .K | |
| Retrocopy | GK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 15 .91 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 11 .42 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 18 .02 RPM |
| SRP007412_heart | 0 .00 RPM | 8 .60 RPM |
| SRP007412_kidney | 0 .00 RPM | 10 .09 RPM |
| SRP007412_liver | 0 .00 RPM | 5 .34 RPM |
| SRP007412_testis | 0 .00 RPM | 24 .46 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000010541 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000014547 | 1 retrocopy | |
| Homo sapiens | ENSG00000137500 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000020154 | 2 retrocopies |
retro_mmul_1880 , retro_mmul_773,
|
| Nomascus leucogenys | ENSNLEG00000016478 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000004144 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000003736 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000004129 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000005459 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000009462 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014665 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000011196 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000003998 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000007753 | 1 retrocopy |