RetrogeneDB ID: | retro_mmul_1643 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 3:162885571..162885974(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MTX2 | ||
| Ensembl ID: | ENSMMUG00000010185 | ||
| Aliases: | MTX2, metaxin-2 | ||
| Description: | metaxin-2 [Source:RefSeq peptide;Acc:NP_001248051] |
| Percent Identity: | 73.19 % |
| Parental protein coverage: | 51.71 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 2 |
| Parental | LYLQWCDEAT-VGEITHARYGSPYPWPLNHILAYQKQWEVKRKMKAIGWGKKTLDQVLEDVDQCCQALSQ |
| LYLQW.DE....GEITHARYGSPYP.PL.HILAYQKQ..VK.K.KAI.WGKKTL.QVLED.DQCCQALSQ | |
| Retrocopy | LYLQWLDEPK<IGEITHARYGSPYPSPLHHILAYQKQ*KVKCKVKAIRWGKKTLEQVLEDIDQCCQALSQ |
| Parental | RLGTQP-YFFNKQPTELDALVFGHLYTILTTQLTNDELSEKVKNYSNLLAFCRRIEQHYFEDRGKGRL |
| .LGT.P..F.NKQ..E.D.LVFGHLYTILTTQL.ND.LSE.VKN.S.LLA.C.R.E.HYF....KGR. | |
| Retrocopy | SLGT*P<MFLNKQLCEFDTLVFGHLYTILTTQLMNDKLSE-VKNCSKLLALCKRNERHYFDYCEKGRM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 19 .94 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 16 .18 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 15 .11 RPM |
| SRP007412_heart | 0 .00 RPM | 13 .07 RPM |
| SRP007412_kidney | 0 .00 RPM | 19 .60 RPM |
| SRP007412_liver | 0 .00 RPM | 5 .19 RPM |
| SRP007412_testis | 0 .11 RPM | 53 .00 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3780 |
| Pan troglodytes | retro_ptro_2561 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000009655 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000011099 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000003848 | 2 retrocopies | |
| Homo sapiens | ENSG00000128654 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010185 | 1 retrocopy |
retro_mmul_1643 ,
|
| Macaca mulatta | ENSMMUG00000021104 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000006020 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000012674 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000016381 | 1 retrocopy |