RetrogeneDB ID: | retro_mmul_1409 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 19:58466070..58466415(-) | ||
| Located in intron of: | ENSMMUG00000020236 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | DPPA5 | ||
| Ensembl ID: | ENSMMUG00000000417 | ||
| Aliases: | None | ||
| Description: | developmental pluripotency associated 5 [Source:HGNC Symbol;Acc:19201] |
| Percent Identity: | 80. % |
| Parental protein coverage: | 99.14 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | GTLPARRNIPPWVKVPEDLKDPEVFQVQTRLLKAMFGPDGSRIPYIEQVSKAMLELKALESSDLTEVVVY |
| G..P.RRN..PWVK.PEDLKDPEV..VQ.RLL.AMFGPDGS.IPYIEQVSK.ML.LKALES.DLTEVVVY | |
| Retrocopy | GNNPRRRNTLPWVKLPEDLKDPEVLLVQMRLLEAMFGPDGSQIPYIEQVSKIMLMLKALESLDLTEVVVY |
| Parental | GSYLYKLRTKWMLQSMAEWHRQRQERGMLKLAEAMTALELGPWMK |
| G.YL.K.RTKWMLQSM.EWH.Q.QERGMLKLAE.MTA.ELGPW.K | |
| Retrocopy | GFYLCKCRTKWMLQSMTEWHCQHQERGMLKLAESMTAVELGPWVK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .08 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .57 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000002647 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000012338 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000009945 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000011544 | 4 retrocopies | |
| Dipodomys ordii | ENSDORG00000000378 | 2 retrocopies | |
| Homo sapiens | ENSG00000203909 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000012001 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000004463 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000000417 | 1 retrocopy |
retro_mmul_1409 ,
|
| Mus musculus | ENSMUSG00000060461 | 7 retrocopies | |
| Pongo abelii | ENSPPYG00000016771 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000029547 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000000199 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000004283 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000005326 | 2 retrocopies |