RetrogeneDB ID: | retro_mmul_1274 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 17:840367..840574(+) | ||
| Located in intron of: | ENSMMUG00000013370 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TMSB4X | ||
| Ensembl ID: | ENSMMUG00000014256 | ||
| Aliases: | None | ||
| Description: | thymosin beta-4 [Source:RefSeq peptide;Acc:NP_001247486] |
| Percent Identity: | 85.51 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | NSVVATAQTRLRSFSCASLRFSSATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| NSVVATAQTRLRSF..ASL.FSSATMSDKP.MAEIEKFDKS.LKKT..QEKNP.PSKE.IEQEKQ.GES | |
| Retrocopy | NSVVATAQTRLRSFLRASLCFSSATMSDKPNMAEIEKFDKSRLKKTRLQEKNPPPSKEAIEQEKQGGES |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 285 .39 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .08 RPM | 489 .94 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 126 .50 RPM |
| SRP007412_heart | 0 .35 RPM | 382 .28 RPM |
| SRP007412_kidney | 0 .23 RPM | 145 .65 RPM |
| SRP007412_liver | 0 .04 RPM | 110 .99 RPM |
| SRP007412_testis | 0 .04 RPM | 27 .25 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000038488 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000006450 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000014256 | 2 retrocopies |
retro_mmul_1274 , retro_mmul_1890,
|
| Pan troglodytes | ENSPTRG00000028317 | 4 retrocopies |