RetrogeneDB ID: | retro_mluc_2068 | ||
Retrocopylocation | Organism: | Microbat (Myotis lucifugus) | |
| Coordinates: | GL430012:788130..788350(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CHURC1 | ||
| Ensembl ID: | ENSMLUG00000004300 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 77.33 % |
| Parental protein coverage: | 66.07 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | FMLITNKSLKEEDGEEIVTYDHLCQNC-HHVVARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDPR |
| FMLITNKSLKEEDGEEIVTYDHL.....H.V....E.TF.IMDEFQE.T.LCLLCGKAED..SILPDDPR | |
| Retrocopy | FMLITNKSLKEEDGEEIVTYDHLLELS>HVVARHEE-TFHIMDEFQEHTALCLLCGKAEDINSILPDDPR |
| Parental | QMTLL |
| QMTL. | |
| Retrocopy | QMTLI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Myotis lucifugus | ENSMLUG00000004300 | 1 retrocopy |
retro_mluc_2068 ,
|
| Monodelphis domestica | ENSMODG00000009664 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000006792 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000001838 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000011384 | 1 retrocopy |