RetrogeneDB ID: | retro_mdom_1775 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 7:56817594..56817822(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CHURC1 | ||
| Ensembl ID: | ENSMODG00000009664 | ||
| Aliases: | None | ||
| Description: | churchill domain containing 1 [Source:HGNC Symbol;Acc:20099] |
| Percent Identity: | 83.54 % |
| Parental protein coverage: | 70.54 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MCGDCVEKEYPNRGNTCLENGSFLLNYVGCAMCNKRDFMLIANKSTKEEDGEEIVTYDHICKNCHHIVAR |
| M.GD.VEK.YPNRGNTCLENGS.LLNYV.CAM.NK.DFMLIANKS.KEEDGEEIVTYDH.CKNCHH.VAR | |
| Retrocopy | MHGDFVEKKYPNRGNTCLENGSLLLNYVDCAMFNK*DFMLIANKSVKEEDGEEIVTYDHVCKNCHHVVAR |
| Parental | HEYTFSVMD |
| ...TFSVMD | |
| Retrocopy | ---TFSVMD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 48 .04 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 56 .48 RPM |
| SRP007412_heart | 0 .00 RPM | 202 .74 RPM |
| SRP007412_kidney | 0 .00 RPM | 122 .47 RPM |
| SRP007412_liver | 0 .00 RPM | 68 .47 RPM |
| SRP007412_testis | 0 .00 RPM | 48 .72 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Myotis lucifugus | ENSMLUG00000004300 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000009664 | 1 retrocopy |
retro_mdom_1775 ,
|
| Mustela putorius furo | ENSMPUG00000006792 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000001838 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000011384 | 1 retrocopy |