RetrogeneDB ID: | retro_mluc_1407 | ||
Retrocopylocation | Organism: | Microbat (Myotis lucifugus) | |
| Coordinates: | GL429832:4855741..4855985(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | BOLA3 | ||
| Ensembl ID: | ENSMLUG00000016364 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 78.05 % |
| Parental protein coverage: | 74.31 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | ASQTDGELKVTQILKESFPRATTIKVTDISGGCGAMYEIQIESEEFKEKRTV-QQHQMVNQALKEEIKGM |
| ASQ...ELKVTQILKE.FP.AT.IK.TDISGG...MYEIQIESEEF.EKRTV.QQ.Q.VNQ.L.EEIKGM | |
| Retrocopy | ASQAERELKVTQILKEHFP*ATAIKLTDISGGSAVMYEIQIESEEFQEKRTV>QQYQTVNQSLREEIKGM |
| Parental | HGLRIFTSVPKH |
| HGL..FTSVPKH | |
| Retrocopy | HGLQKFTSVPKH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000008739 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000017844 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000008309 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000016364 | 1 retrocopy |
retro_mluc_1407 ,
|
| Mustela putorius furo | ENSMPUG00000007813 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000045160 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000016658 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000003502 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000001754 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000008291 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000006698 | 3 retrocopies |