RetrogeneDB ID: | retro_meug_281 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
| Coordinates: | GeneScaffold_9276:100586..100969(+) | ||
| Located in intron of: | ENSMEUG00000015292 | ||
Retrocopyinformation | Ensembl ID: | ENSMEUG00000015303 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | H3F3A | ||
| Ensembl ID: | ENSMEUG00000004090 | ||
| Aliases: | None | ||
| Description: | H3 histone, family 3A [Source:HGNC Symbol;Acc:4764] |
| Percent Identity: | 50.75 % |
| Parental protein coverage: | 97.79 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | RTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLI-RKLPFQRL |
| .TKQT....T.GKA...........K..PS.G.V....RY.PG.VAL.E...YQ.STEL...R.LP.Q.L | |
| Retrocopy | KTKQTTHIFTVGKAQHQ----QNSAKRTPSAGRVEQSDRYQPGIVALCESCPYQMSTELSL<RQLPSQWL |
| Parental | VREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER |
| .REI..DFKT.L.FQ.A....L.EASE..L..L.ED....AIHAKR.TI.PKDI...RR.R..R | |
| Retrocopy | TREISSDFKTCLGFQIAGENTLKEASEVHLCVL-EDN*PSAIHAKRITIIPKDIE*VRRYRQKR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000024561 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000004916 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000016119 | 4 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000013796 | 1 retrocopy | |
| Felis catus | ENSFCAG00000003617 | 4 retrocopies | |
| Felis catus | ENSFCAG00000030424 | 5 retrocopies | |
| Gadus morhua | ENSGMOG00000014306 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000004090 | 5 retrocopies | |
| Macaca mulatta | ENSMMUG00000031483 | 9 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000001577 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000024312 | 11 retrocopies | |
| Otolemur garnettii | ENSOGAG00000025933 | 14 retrocopies | |
| Oreochromis niloticus | ENSONIG00000015805 | 7 retrocopies | |
| Pongo abelii | ENSPPYG00000008636 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000008459 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000023971 | 2 retrocopies |