RetrogeneDB ID: | retro_meug_1350 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
| Coordinates: | Scaffold376818:1022..1251(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMEUG00000013119 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 57.14 % |
| Parental protein coverage: | 70.48 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | KVNAC--GTDVIALTKQVLKGSRSSELLGQAARNMVLQEDAILHSEDSLRKMAIITTHLQ-YQQEAIQKN |
| .VN.C......I.LTK....GS.S.ELLG..A.NMVL...AIL.S.D...KMAI...H.Q.YQQEAIQKN | |
| Retrocopy | RVNICIMSDGMILLTKKGVNGSWSCELLGKEAQNMVLP*GAILCSKDHFSKMAIKIIHFQ>YQQEAIQKN |
| Parental | VELSSNL |
| VE.S.NL | |
| Retrocopy | VEKSPNL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000021622 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000020646 | 4 retrocopies | |
| Macropus eugenii | ENSMEUG00000013119 | 3 retrocopies |
retro_meug_112, retro_meug_1350 , retro_meug_231,
|
| Otolemur garnettii | ENSOGAG00000032692 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000000834 | 1 retrocopy |