RetrogeneDB ID: | retro_lafr_1177 | ||
Retrocopylocation | Organism: | Elephant (Loxodonta africana) | |
| Coordinates: | scaffold_80:5356305..5356464(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSLAFG00000020646 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 81.13 % |
| Parental protein coverage: | 50.48 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | RNMVLQEDAILHSEDSLRKMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLLK |
| RNM.LQEDAILH..DSLR.MAIITTHLQYQQEAI.KNVEQSS.L.DQ...LLK | |
| Retrocopy | RNMILQEDAILHTKDSLRTMAIITTHLQYQQEAIWKNVEQSSALRDQFDYLLK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000021622 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000020646 | 4 retrocopies | |
| Macropus eugenii | ENSMEUG00000013119 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000032692 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000000834 | 1 retrocopy |