RetrogeneDB ID: | retro_mdom_840 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 2:173668439..173668667(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SUB1 | ||
| Ensembl ID: | ENSMODG00000020410 | ||
| Aliases: | None | ||
| Description: | SUB1 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:19985] |
| Percent Identity: | 63.16 % |
| Parental protein coverage: | 53.24 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 0 |
| Parental | KTGESSKAPASSKQSSSRDDHMFQIGKMRYVSVRDFKGKVLIDIREYWMDQEG--EMKPGRKGISLNPEQ |
| KT.E.SK.PAS.KQS.....HMFQIGKMRYVSV.DF..KVLID.R.YWM........KP.RK..SLN.EQ | |
| Retrocopy | KTEEISKVPASFKQSNR*GVHMFQIGKMRYVSV*DFTRKVLIDSRKYWMESGW*FKIKPSRKSNSLNQEQ |
| Parental | WSQLKE |
| ..QLKE | |
| Retrocopy | HGQLKE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |