RetrogeneDB ID: | retro_mdom_550 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 1:269653672..269653933(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SNRPF | ||
| Ensembl ID: | ENSMODG00000008091 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein polypeptide F [Source:HGNC Symbol;Acc:11162] |
| Percent Identity: | 67.82 % |
| Parental protein coverage: | 76.32 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | TMSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNV |
| TM.L.LN.K.FLN.L.GK...VKLK...EYKGYL.S.DGYMN.QL.NTE.YIDG.L..HLGE.LIRC.NV | |
| Retrocopy | TMCLRLNCKLFLNRLSGKLLIVKLKCRIEYKGYLISMDGYMNIQLVNTEKYIDGTLCQHLGEMLIRCKNV |
| Parental | LYIRGVEEEEEDGEMRE |
| L....V.EEEEDGEM.E | |
| Retrocopy | LWMKSV*EEEEDGEM*E |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000002166 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000006395 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000002705 | 2 retrocopies | |
| Felis catus | ENSFCAG00000029966 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000000526 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000008091 | 3 retrocopies |
retro_mdom_550 , retro_mdom_780, retro_mdom_811,
|
| Tarsius syrichta | ENSTSYG00000006837 | 4 retrocopies |