RetrogeneDB ID: | retro_mdom_1288 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 4:295969136..295969334(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | COX7A1 | ||
| Ensembl ID: | ENSMODG00000025577 | ||
| Aliases: | None | ||
| Description: | cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) [Source:HGNC Symbol;Acc:2287] |
| Percent Identity: | 63.64 % |
| Parental protein coverage: | 92.96 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | RSFSSSSRNFFENRVAEKQKLFQENNDLPVYLKGGTGDQLLFTITMTMSVVGTGYCLFFLTWASFP |
| .SFSSS.RN.F.N.VAEK.KLFQENNDLPV.L.G...D.LL...T..M...GT.Y.LF.L.WASFP | |
| Retrocopy | QSFSSSTRNHFVNKVAEKLKLFQENNDLPVHLQGKGQDNLLYK*TIAMCLEGTSYSLFCLGWASFP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000012840 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000007654 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000012331 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000000250 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000025577 | 1 retrocopy |
retro_mdom_1288 ,
|
| Pan troglodytes | ENSPTRG00000010888 | 1 retrocopy |