RetrogeneDB ID: | retro_chof_305 | ||
Retrocopylocation | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | GeneScaffold_6979:17035..17233(+) | ||
| Located in intron of: | ENSCHOG00000002676 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | COX7A1 | ||
| Ensembl ID: | ENSCHOG00000012840 | ||
| Aliases: | None | ||
| Description: | cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) [Source:HGNC Symbol;Acc:2287] |
| Percent Identity: | 53.03 % |
| Parental protein coverage: | 88. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | RSFGSTARHRFQNRVAEKQKLFQADNDLPVHLKGGGTDNILYRLTMGLCLGGSAYSVYCLGWASYP |
| R.........F.N.V.EKQKLFQ..N..PVHLKGG..D..LYR.TM.L..GG..Y..Y.LG.AS.P | |
| Retrocopy | RTVSTASCRQFENKVPEKQKLFQDGNGIPVHLKGGIADALLYRATMVLTVGGTMYAMYQLGMASFP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000012840 | 1 retrocopy |
retro_chof_305 ,
|
| Echinops telfairi | ENSETEG00000007654 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000012331 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000000250 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000025577 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000010888 | 1 retrocopy |