RetrogeneDB ID: | retro_lafr_648 | ||
Retrocopylocation | Organism: | Elephant (Loxodonta africana) | |
| Coordinates: | scaffold_28:5403314..5403536(-) | ||
| Located in intron of: | ENSLAFG00000002717 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SRP9 | ||
| Ensembl ID: | ENSLAFG00000004081 | ||
| Aliases: | None | ||
| Description: | Signal recognition particle 9 kDa protein [Source:UniProtKB/TrEMBL;Acc:G3STL4] |
| Percent Identity: | 81.08 % |
| Parental protein coverage: | 86.05 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MPQFQTWEEFSRAAEKLYLADPMKARVVLKYRHTDGSLCIKVTDDLVCLVYRTDQAQDVKKIEKFHSQLM |
| M.Q.Q.WE.FS.AAEKLYL..P.KA.VVLKYRHTDG.LCIKVTDD.VCLVYRT..AQDVKKI.KFHSQLM | |
| Retrocopy | MLQYQAWEKFSMAAEKLYLTGPIKAPVVLKYRHTDGNLCIKVTDDSVCLVYRTNHAQDVKKIQKFHSQLM |
| Parental | RLMV |
| RLMV | |
| Retrocopy | RLMV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000016162 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000013412 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000012291 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000004081 | 3 retrocopies |
retro_lafr_1184, retro_lafr_377, retro_lafr_648 ,
|
| Otolemur garnettii | ENSOGAG00000001752 | 1 retrocopy |