RetrogeneDB ID: | retro_cfam_1034 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 21:26884426..26884659(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SRP9 | ||
| Ensembl ID: | ENSCAFG00000016162 | ||
| Aliases: | None | ||
| Description: | signal recognition particle 9kDa [Source:HGNC Symbol;Acc:11304] |
| Percent Identity: | 83.54 % |
| Parental protein coverage: | 89.53 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSD-GSLCIKVTDDLVC-LVYRTDQAQDVKKIEKFHSQ |
| MPQYQTWEEFS..A...YL.DPMKARVVLKYR.S..GS.CIKVTDDLVC.LVYRTDQAQDVKKIEKFHSQ | |
| Retrocopy | MPQYQTWEEFSCSAKNFYLPDPMKARVVLKYRPSE>GSFCIKVTDDLVC>LVYRTDQAQDVKKIEKFHSQ |
| Parental | LMRLMVAKE |
| LMR..VAKE | |
| Retrocopy | LMRRVVAKE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 23 .48 RPM |
| SRP017611_brain | 0 .00 RPM | 16 .83 RPM |
| SRP017611_kidney | 0 .00 RPM | 19 .02 RPM |
| SRP017611_liver | 0 .00 RPM | 3 .63 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000016162 | 2 retrocopies |
retro_cfam_1034 , retro_cfam_1527,
|
| Dasypus novemcinctus | ENSDNOG00000013412 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000012291 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000004081 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000001752 | 1 retrocopy |