RetrogeneDB ID: | retro_itri_810 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393326.1:7967923..7968267(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | BTF3L4 | ||
| Ensembl ID: | ENSSTOG00000006129 | ||
| Aliases: | None | ||
| Description: | basic transcription factor 3-like 4 [Source:HGNC Symbol;Acc:30547] |
| Percent Identity: | 74.79 % |
| Parental protein coverage: | 74.05 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | ATADDKKLQSSLKK-LAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPG |
| AT.D.KKL.SSL...LAVNNIAGIEEVNMIK...T.IHF...KVQASLSANTFA.TGHA.A.PIT.M... | |
| Retrocopy | ATSDYKKL*SSLXXXLAVNNIAGIEEVNMIKVEETLIHF---KVQASLSANTFASTGHAVAEPITQMFLK |
| Parental | -ILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLVEN |
| .ILSQ.GADSLTSLRK.A..FP.QVLDSKAPKP.DIDEEDD.VPDL..N | |
| Retrocopy | <ILSQFGADSLTSLRKIA*WFPQQVLDSKAPKPDDIDEEDDNVPDLIKN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000021582 | 4 retrocopies | |
| Cavia porcellus | ENSCPOG00000004006 | 1 retrocopy | |
| Ciona savignyi | ENSCSAVG00000009653 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000003181 | 4 retrocopies | |
| Echinops telfairi | ENSETEG00000011923 | 11 retrocopies | |
| Loxodonta africana | ENSLAFG00000016124 | 3 retrocopies | |
| Macropus eugenii | ENSMEUG00000006135 | 10 retrocopies | |
| Myotis lucifugus | ENSMLUG00000016884 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000003636 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000000770 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000028568 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000001517 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000030256 | 2 retrocopies | |
| Procavia capensis | ENSPCAG00000006428 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000001353 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000008512 | 8 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000006129 | 6 retrocopies | |
| Tarsius syrichta | ENSTSYG00000013635 | 3 retrocopies |