RetrogeneDB ID: | retro_itri_735 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393314.1:11932608..11932853(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSTOG00000005297 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 59.04 % |
| Parental protein coverage: | 52.56 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | AVPQPGGTRPRIQYKFSKWQLQ-ELESVFQVTQYPDVATRRELARCMNVSEARVQAWFKYRRAKHRKTLR |
| AV.Q.....P.IQ.KFSKWQLQ.ELESVFQ.TQY..V.TR..LARC.NV.E.RVQA....RRA.HR...R | |
| Retrocopy | AVLQLWHSHPPIQSKFSKWQLQ<ELESVFQLTQYSNVTTRKGLARCINVTETRVQA*LNKRRAQHRNHQR |
| Parental | ETSLRNAPHPTQD |
| ...L..AP...QD | |
| Retrocopy | KLMLGDAPSGLQD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Otolemur garnettii | ENSOGAG00000030871 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000030942 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000009422 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000005297 | 1 retrocopy |
retro_itri_735 ,
|
| Tupaia belangeri | ENSTBEG00000002729 | 1 retrocopy |