RetrogeneDB ID: | retro_itri_365 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393286.1:3606571..3606904(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSTOG00000020231 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 57.76 % |
| Parental protein coverage: | 55.5 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 0 |
| Parental | PSFTITVTSEAGENDESKLLSIFLRSAEENLGMVMIFTLVTAVQEKLNEIVDQIKTRREEEKKQKEREAE |
| P...I........ND.S..L......AEENLG.V.IFT.V.AV...LN..VDQI.TRREEEKKQ.E.EAE | |
| Retrocopy | PLYEIFSQENLEDNDVSDVLKLLTLEAEENLGIVIIFTPVAAV*KELNVVVDQI*TRREEEKKQTEKEAE |
| Parental | EAEKQLFHGTPVTIENFLSWKAKFDAELLEIKKKRMKEEEQAGKNK |
| ....Q.FHG.PVT.ENF.SW.AK.DAELLEI..K..K..EQ.GKNK | |
| Retrocopy | ---NQ*FHGNPVTVENFSSWTAKSDAELLEIQRKWVK--EQVGKNK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000005692 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000009689 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000004474 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000007516 | 1 retrocopy | |
| Equus caballus | ENSECAG00000006587 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000019085 | 3 retrocopies | |
| Loxodonta africana | ENSLAFG00000008170 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017837 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000013592 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000005016 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000020231 | 2 retrocopies |
retro_itri_121, retro_itri_365 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000022124 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000002543 | 2 retrocopies |