RetrogeneDB ID: | retro_itri_1449 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393492.1:2776879..2777122(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSSTOG00000019436 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | HN1 | ||
| Ensembl ID: | ENSSTOG00000015171 | ||
| Aliases: | None | ||
| Description: | hematological and neurological expressed 1 [Source:HGNC Symbol;Acc:14569] |
| Percent Identity: | 76.54 % |
| Parental protein coverage: | 51.95 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MTTTTTFKGVDPNSRNSSRVLRPP-GGGSNFSLGFDEPTEQPVRKNKMASSIFGTPEENPPSWAKSAGAK |
| MT.T.TFKG.DP..RNSS..L.PP..GGSNFSLGFDEPTE...RKNKMASSIFGTPEENPPSWAK...AK | |
| Retrocopy | MTNTNTFKGFDPKIRNSSWILQPPWAGGSNFSLGFDEPTESSMRKNKMASSIFGTPEENPPSWAKLTDAK |
| Parental | SSGGREDLESS |
| .SGG..DLESS | |
| Retrocopy | DSGGSKDLESS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000014553 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000013294 | 1 retrocopy | |
| Homo sapiens | ENSG00000189159 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000013996 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000013971 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000020737 | 6 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000000610 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000002950 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000010887 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000024246 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000003661 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000015171 | 1 retrocopy |
retro_itri_1449 ,
|