RetrogeneDB ID: | retro_itri_1081 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393371.1:2902511..2902706(+) | ||
| Located in intron of: | ENSSTOG00000012050 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ELOF1 | ||
| Ensembl ID: | ENSSTOG00000003687 | ||
| Aliases: | None | ||
| Description: | elongation factor 1 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:28691] |
| Percent Identity: | 55.07 % |
| Parental protein coverage: | 79.52 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 3 |
| Parental | KKMTGTLETQFTCPF-CNHE-KSCDVKMDRARNTGVISCTVCLEEF-QTPITYLSEPVDVYSDWIDACE |
| K....TLET.FT.PF.CNH..K..DVKMD...NTGVIS.....EEF....IT.LSE.V.VY...I..CE | |
| Retrocopy | KLQEDTLETKFT*PF<CNHL<KFHDVKMDHDHNTGVISFIAFPEEF<LDDITCLSESVNVYIS*IVVCE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000000064 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000020359 | 1 retrocopy | |
| Felis catus | ENSFCAG00000004926 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000001534 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000012101 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000026211 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000003687 | 1 retrocopy |
retro_itri_1081 ,
|
| Tupaia belangeri | ENSTBEG00000004812 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000001807 | 1 retrocopy |