RetrogeneDB ID: | retro_ggor_422 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 1:109369273..109369652(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | OOEP | ||
| Ensembl ID: | ENSGGOG00000016832 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 60.47 % |
| Parental protein coverage: | 85.23 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | SQRGKQTPAHSLEQLRGLPLP-PPQIRIRP-WWFPVQELRDPLVFYLEAWLADELFGPDRGIIPEMEWTS |
| ...GK.TP.HS.E.L..LPLP.PPQI.....WWF.VQEL..P.VFYLE.WLAD..F..DR..IP..EW.S | |
| Retrocopy | AESGKWTPSHSMEKLLRLPLP<PPQILMGS<WWFLVQELGGPSVFYLEVWLADVIFEADRAVIPGLEWMS |
| Parental | QALLTVDIVDSGNLVEITVFGRPRVQNRVKSMLLCLAWFHREHRARAEKMKHLEKNLKA |
| ..LL.VDIVDSG..V.IT.FG...V.NRVK.M.LC..W.H..H.A.AEK.KHLE.NLKA | |
| Retrocopy | LSLLMVDIVDSGIQVKITIFGQLCVWNRVKCMFLCVTWLHQQHHA*AEKIKHLEENLKA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 3 .11 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_432 |
| Pan troglodytes | retro_ptro_329 |
| Macaca mulatta | retro_mmul_519 |
| Callithrix jacchus | retro_cjac_3033 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000009962 | 1 retrocopy | |
| Homo sapiens | ENSG00000203907 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000016832 | 3 retrocopies |
retro_ggor_2992, retro_ggor_422 , retro_ggor_495,
|
| Loxodonta africana | ENSLAFG00000012754 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000017174 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000000416 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000001204 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000025904 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000029545 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000025957 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000001487 | 2 retrocopies |