RetrogeneDB ID: | retro_ggor_2759 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 8:110170598..110170982(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSGGOG00000023880 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NDUFB9 | ||
| Ensembl ID: | ENSGGOG00000015883 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 [Source:UniProtKB/Swiss-Prot;Acc:Q0MQE9] |
| Percent Identity: | 65.38 % |
| Parental protein coverage: | 71.51 % |
| Number of stop codons detected: | 5 |
| Number of frameshifts detected | 2 |
| Parental | KNEKDMAKATQLLKEAEEEFWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFAK |
| .NEKD....TQLL...EEEFW..Q.PQP.IF.....GTS.ERY.CYKVP.W.LD.W.PSEKAMYPDY.AK | |
| Retrocopy | QNEKDIIRTTQLLRGTEEEFWHCQPPQP*IFHGCLEGTSNERYKCYKVP*WFLDNWLPSEKAMYPDYCAK |
| Parental | REQWKKLRRESWEREVKQLQEETPPGGPLTE-ALPPARKEGDLPPLWWYIVTR-PRERPM |
| REQWK.L.RESWE.EVKQLQEE.PPGGP....AL.P..KE....PL...IVTR..RE.PM | |
| Retrocopy | REQWK*LWRESWE*EVKQLQEEIPPGGPKIK<ALLPSGKESNFLPLQLCIVTR>SRE*PM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 74 .57 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 39 .36 RPM |
| SRP007412_heart | 0 .00 RPM | 75 .42 RPM |
| SRP007412_kidney | 0 .00 RPM | 81 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 40 .73 RPM |
| SRP007412_testis | 0 .00 RPM | 59 .88 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4112 |
| Pan troglodytes | retro_ptro_2791 |
| Pongo abelii | retro_pabe_3366 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000010022 | 1 retrocopy | |
| Ailuropoda melanoleuca | ENSAMEG00000015852 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000012818 | 1 retrocopy | |
| Equus caballus | ENSECAG00000018238 | 1 retrocopy | |
| Felis catus | ENSFCAG00000004678 | 1 retrocopy | |
| Homo sapiens | ENSG00000147684 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000015883 | 2 retrocopies |
retro_ggor_2632, retro_ggor_2759 ,
|
| Microcebus murinus | ENSMICG00000017481 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000003765 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015493 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000001831 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005484 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000030772 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000018869 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000020569 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000009153 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000021955 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000006895 | 3 retrocopies |