RetrogeneDB ID: | retro_ggor_2610 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 7:91045442..91045867(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TSN | ||
| Ensembl ID: | ENSGGOG00000002216 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 60.96 % |
| Parental protein coverage: | 63.16 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | YRFHEHWRFVLQRLVFLAAFVVYLETETLVTREAVTEILGIEPDREKGFHLDVEDYLSGVL-ILASELSR |
| ...HEHWRF.LQ..V.....V..LETE...T.EA.TEI..IEPD.EK.FH.DVED.LSGV..ILASEL.R | |
| Retrocopy | HEVHEHWRFALQHTVVFPELVACLETE---TPEAITEIRVIEPDKEKRFHVDVEDPLSGVQ<ILASELLR |
| Parental | LSVNSVTAGDYSRPLHISTFINELDSGFRLLNLKN-DSLRKRYDGLKYDVKKVEEVVYDLSIRGFNKETA |
| LS.....AGD.S.PLH..TF.NE....F.LL.LK...SLRK.YDGL..DVKK.EEV.Y.LSI.GFN.E.. | |
| Retrocopy | LSLSGMSAGDNSQPLHVATFNNEWHPNFHLLSLKHYSSLRKPYDGLW*DVKKTEEVFYILSIQGFNNEIE |
| Parental | AACVEK |
| AAC.EK | |
| Retrocopy | AACTEK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 43 .97 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 36 .96 RPM |
| SRP007412_heart | 0 .00 RPM | 7 .16 RPM |
| SRP007412_kidney | 0 .00 RPM | 77 .12 RPM |
| SRP007412_liver | 0 .00 RPM | 27 .38 RPM |
| SRP007412_testis | 0 .00 RPM | 114 .06 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000006059 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000025740 | 2 retrocopies | |
| Felis catus | ENSFCAG00000027149 | 1 retrocopy | |
| Homo sapiens | ENSG00000211460 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000002216 | 2 retrocopies |
retro_ggor_2528, retro_ggor_2610 ,
|
| Myotis lucifugus | ENSMLUG00000012656 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000021119 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000000147 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000001202 | 1 retrocopy | |
| Ornithorhynchus anatinus | ENSOANG00000003457 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000023529 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000030436 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000012420 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000004395 | 1 retrocopy |