RetrogeneDB ID: | retro_dnov_1581 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_239230:7..388(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TSN | ||
| Ensembl ID: | ENSDNOG00000025740 | ||
| Aliases: | None | ||
| Description: | translin [Source:HGNC Symbol;Acc:12379] |
| Percent Identity: | 72.18 % |
| Parental protein coverage: | 63.11 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 3 |
| Parental | SLEQTAREILTLLQGVHQGAGFQDIP-KRCLKAR-EHFGTVKTHLTSLKTKFPAEQYYRFHEHWRFVLQR |
| SLEQTA.EI..LLQG..QGAG..DI..KRCLKA..EHFGTVKTHLTSLK.KFP..QY.RFH.H.RFVLQ. | |
| Retrocopy | SLEQTAPEIPALLQGNYQGAGMLDIQ<KRCLKAE<EHFGTVKTHLTSLKIKFPDDQYFRFHDHCRFVLQC |
| Parental | LVFLAAFVVYLESETLVTREAVTEILGIEPDREKGFHLDVE-DYLSGVLILASELSRLSVNSV |
| LV..AAF.V.LESETLVT.E.VTEI.G.E.D.EK.FHLDVE.DYL....IL.SELS.LSVNS. | |
| Retrocopy | LV-SAAFAVFLESETLVTPELVTEIFGLELDGEKRFHLDVE<DYLY-EFILPSELSMLSVNSM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 11 .08 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 12 .37 RPM |
| SRP012922_heart | 0 .00 RPM | 3 .25 RPM |
| SRP012922_kidney | 0 .00 RPM | 6 .30 RPM |
| SRP012922_liver | 0 .00 RPM | 5 .73 RPM |
| SRP012922_lung | 0 .00 RPM | 8 .71 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 3 .81 RPM |
| SRP012922_spleen | 0 .00 RPM | 11 .10 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000006059 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000025740 | 2 retrocopies |
retro_dnov_1581 , retro_dnov_907,
|
| Felis catus | ENSFCAG00000027149 | 1 retrocopy | |
| Homo sapiens | ENSG00000211460 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000002216 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000012656 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000021119 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000000147 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000001202 | 1 retrocopy | |
| Ornithorhynchus anatinus | ENSOANG00000003457 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000023529 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000030436 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000012420 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000004395 | 1 retrocopy |