RetrogeneDB ID: | retro_ggor_2507 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 7:23887611..23887839(+) | ||
| Located in intron of: | ENSGGOG00000026042 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | FCF1 | ||
| Ensembl ID: | ENSGGOG00000016318 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 90.79 % |
| Parental protein coverage: | 62.81 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MGKQKKTRKYATMKRMLSLRDQRLKEKDRLKPKKKEKKDPSALKEREVPQHPSCLFFQYNTQLGPPYHIL |
| MGKQKKTRKYATMKRML.LRD.RLKEKDRLKP.KKE.KDPSALKEREVPQHPSCLFFQ.N.QLGPPY.IL | |
| Retrocopy | MGKQKKTRKYATMKRMLKLRDHRLKEKDRLKPTKKEEKDPSALKEREVPQHPSCLFFQCNAQLGPPYYIL |
| Parental | VDTNFI |
| VDTNFI | |
| Retrocopy | VDTNFI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 3 .55 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 3 .03 RPM |
| SRP007412_heart | 0 .03 RPM | 0 .66 RPM |
| SRP007412_kidney | 0 .00 RPM | 4 .09 RPM |
| SRP007412_liver | 0 .03 RPM | 1 .71 RPM |
| SRP007412_testis | 0 .10 RPM | 7 .36 RPM |