RetrogeneDB ID: | retro_ggor_1481 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 19:35050861..35051146(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSGGOG00000024659 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSGGOG00000000681 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 88.42 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MVYISNGQVLDSRSQSPWRLSLITDFFWGIAEFVVLFFKTLLQQDVKKRRSYGNSSDSRY-DDGRGPPGN |
| MVYISN.QVLDS.SQSPWRLSLITDFFWGIAEFVVLFFKTLL.QD.KKRRSYGNSSD.RY.DDGRGP.GN | |
| Retrocopy | MVYISNAQVLDSWSQSPWRLSLITDFFWGIAEFVVLFFKTLLWQDLKKRRSYGNSSDFRYDDDGRGPLGN |
| Parental | PPRRMGRINHLRGPSPPPMAGGUGR |
| PP.RMG.INHL.GPSPPPMAGG.GR | |
| Retrocopy | PPGRMGPINHLGGPSPPPMAGG*GR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .14 RPM | 15 .97 RPM |
| SRP007412_cerebellum | 0 .16 RPM | 14 .62 RPM |
| SRP007412_heart | 0 .00 RPM | 9 .41 RPM |
| SRP007412_kidney | 0 .00 RPM | 16 .23 RPM |
| SRP007412_liver | 0 .03 RPM | 13 .48 RPM |
| SRP007412_testis | 0 .52 RPM | 37 .09 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2055 |
| Pan troglodytes | retro_ptro_1370 |
| Pongo abelii | retro_pabe_107 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000007612 | 8 retrocopies | |
| Cavia porcellus | ENSCPOG00000007172 | 4 retrocopies | |
| Homo sapiens | ENSG00000113811 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000000681 | 2 retrocopies |
retro_ggor_1481 , retro_ggor_2375,
|
| Microcebus murinus | ENSMICG00000017513 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000012622 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000019272 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000042682 | 9 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000026533 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000002266 | 6 retrocopies | |
| Pongo abelii | ENSPPYG00000025894 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000015030 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000016291 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000014624 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000011459 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000000506 | 2 retrocopies |