RetrogeneDB ID: | retro_ggor_1386 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 18:58667213..58667573(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CCDC59 | ||
| Ensembl ID: | ENSGGOG00000025296 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 52.38 % |
| Parental protein coverage: | 50.62 % |
| Number of stop codons detected: | 5 |
| Number of frameshifts detected | 4 |
| Parental | QVHQPLLE-EQCSIDQPLFEDQCSFDQPQPEEQSIKT-VNSFTIPKKNK-KKTSNQKAQEEYEQVQAKRA |
| .V.QPLLE.EQCSI...L.E......Q.QPEEQ..K..VNS.TI......K.TS..KA..E.E.V.AK.A | |
| Retrocopy | KVVQPLLE<EQCSIT*GLSEEHFTIEQLQPEEQCSKM>VNSITIXXXXX>KETSSRKARAECE*VEAKHA |
| Parental | AKKQEFERRKQEREEAQRQYKK-KKMEVFKILNKKTKKGQPNLNVQMEYLLQKIQE |
| AKKQE..R.....E......K..KKM.VF.IL.KKT.KGQPNLN..ME.LL..I.. | |
| Retrocopy | AKKQE--RERIK*EKSSKAPKQ<KKMQVFQILSKKTRKGQPNLNLYME*LLH*IHK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 4 .75 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 4 .37 RPM |
| SRP007412_heart | 0 .00 RPM | 1 .91 RPM |
| SRP007412_kidney | 0 .00 RPM | 6 .62 RPM |
| SRP007412_liver | 0 .00 RPM | 5 .64 RPM |
| SRP007412_testis | 0 .00 RPM | 25 .80 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000016875 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000036282 | 4 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000007788 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000011546 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000003005 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000000256 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025296 | 2 retrocopies |
retro_ggor_1386 , retro_ggor_99,
|
| Microcebus murinus | ENSMICG00000000967 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000017824 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000004383 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000005266 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000008887 | 7 retrocopies |