RetrogeneDB ID: | retro_btau_726 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
| Coordinates: | 18:50928841..50929234(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CCDC59 | ||
| Ensembl ID: | ENSBTAG00000036282 | ||
| Aliases: | None | ||
| Description: | Thyroid transcription factor 1-associated protein 26 [Source:UniProtKB/Swiss-Prot;Acc:A5PJN1] |
| Percent Identity: | 62.32 % |
| Parental protein coverage: | 56.43 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | YPDHLKHLYLAEEERLKKQLRKADQPLSEEQVDQPLPEDQGSSDQALSEERCSIEQPQPAEPCSIRINSI |
| .P.H..HL.LA.EERL.KQLRKADQ...E.Q..Q.LPEDQG..DQALSE..CS.E...P...CS.RI.S. | |
| Retrocopy | HPGHWNHLSLAGEERLSKQLRKADQSWLE-QGEQSLPEDQGTPDQALSEGHCSTERLLPEGHCSTRIYSM |
| Parental | -NIPKKNKKKTSNQKAQEEYEQIQAKRAAKKQEFERRKQEREEAQRLYKKKK-MEVFKILSKKTKKGQ |
| .NIPK...KKTSNQKA.EEYE..QA..AAKKQE.ER.KQE..E....Y..KK.MEVFK.LS.KT..GQ | |
| Retrocopy | >NIPK--QKKTSNQKAHEEYE--QAPCAAKKQEYERQKQETGEPAKRYQHKK<MEVFKMLSQKTQNGQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 24 .95 RPM |
| ERP005899_muscle | 0 .11 RPM | 11 .19 RPM |
| SRP017611_brain | 0 .00 RPM | 16 .08 RPM |
| SRP017611_kidney | 0 .00 RPM | 16 .00 RPM |
| SRP017611_liver | 0 .00 RPM | 10 .87 RPM |
| SRP030211_testis | 0 .00 RPM | 109 .83 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000016875 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000036282 | 4 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000007788 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000011546 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000003005 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000000256 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025296 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000000967 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000017824 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000004383 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000005266 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000008887 | 7 retrocopies |