RetrogeneDB ID: | retro_fcat_2002 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
| Coordinates: | X:82673020..82673463(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | EMC3 | ||
| Ensembl ID: | ENSFCAG00000024898 | ||
| Aliases: | None | ||
| Description: | ER membrane protein complex subunit 3 [Source:HGNC Symbol;Acc:23999] |
| Percent Identity: | 64. % |
| Parental protein coverage: | 56.7 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected | 2 |
| Parental | NVTNVLPMILIGGWINMTFSGFVTT-KVPFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVF-GLRS |
| N..N.LPMILIG.WI...FSG..T..K..F.LT..FK..LQQ.I.L..LDA.W.SSASWYF.NVF.G.R. | |
| Retrocopy | NEPNALPMILIG*WISIIFSGSITR>KISFSLTHHFKSRLQQ*IKLFSLDAFWISSASWYFTNVF>GFRA |
| Parental | IYSLILGQDNAADQSRMMQEQMTGAAMAMPADTNKAFKTEWEALELTDHQWALDDVEEELMAKDLHFEGM |
| ...LILGQD.AA.QS.M.Q.Q.T.A...MP.D.NKAFKTE.E..EL..HQ.ALD.VEEELM.KDLHFE.M | |
| Retrocopy | -FTLILGQDAAAGQSHMTQQQKTRATKNMPTDNNKAFKTE*EPIELAHHQQALDNVEEELMTKDLHFESM |
| Parental | FKKELQTSIF |
| FKKE..TSIF | |
| Retrocopy | FKKES*TSIF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 80 .46 RPM |
| SRP017611_kidney | 0 .00 RPM | 86 .77 RPM |
| SRP017611_liver | 0 .00 RPM | 60 .35 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000005202 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000037305 | 1 retrocopy | |
| Equus caballus | ENSECAG00000024410 | 1 retrocopy | |
| Felis catus | ENSFCAG00000024898 | 2 retrocopies |
retro_fcat_1932, retro_fcat_2002 ,
|
| Microcebus murinus | ENSMICG00000002333 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000017149 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000012615 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000007554 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000003247 | 2 retrocopies |