RetrogeneDB ID: | retro_fcat_1851 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
| Coordinates: | F2:48219664..48219889(-) | ||
| Located in intron of: | ENSFCAG00000005022 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPS26 | ||
| Ensembl ID: | ENSFCAG00000013977 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S26 [Source:HGNC Symbol;Acc:10414] |
| Percent Identity: | 86.84 % |
| Parental protein coverage: | 66.09 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | FVIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRFRPAGAAP |
| FVI.NIVEAAAV.DISEASV.DA.VLPKLYVKLHYCVSCAIH.KVVRNRS.EARKDRTPPPRFR.A.AAP | |
| Retrocopy | FVIQNIVEAAAVKDISEASV-DA*VLPKLYVKLHYCVSCAIHNKVVRNRSHEARKDRTPPPRFRSAAAAP |
| Parental | RPPPKP |
| .PP.KP | |
| Retrocopy | QPPSKP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .23 RPM | 39 .94 RPM |
| SRP017611_kidney | 0 .10 RPM | 119 .55 RPM |
| SRP017611_liver | 0 .00 RPM | 78 .95 RPM |