RetrogeneDB ID: | retro_cpor_1231 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_59:7615731..7615968(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCPOG00000023630 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 70.89 % |
| Parental protein coverage: | 68.7 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | KKFVIRNIVEAAAVRDISEASVFDGYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRFRPAGA |
| KKF.I.NIVEA....DI...SVF.GYVL.KL.VKLHYC.SCAIH.KV.RN.SREA.KD.TP.P.FR.AGA | |
| Retrocopy | KKFII*NIVEATTIGDITKMSVFNGYVLLKLCVKLHYCESCAIHRKVIRNSSREAQKD*TPAPQFRSAGA |
| Parental | APRPPPKPM |
| AP.P.PKPM | |
| Retrocopy | APWPAPKPM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 48 .72 RPM |
| SRP017611_kidney | 0 .00 RPM | 96 .31 RPM |
| SRP017611_liver | 0 .00 RPM | 83 .66 RPM |
| SRP040447_lung | 0 .00 RPM | 131 .70 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 157 .38 RPM |