RetrogeneDB ID: | retro_fcat_142 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
| Coordinates: | A1:600852..601098(+) | ||
| Located in intron of: | ENSFCAG00000031561 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | LAMTOR1 | ||
| Ensembl ID: | ENSFCAG00000005320 | ||
| Aliases: | None | ||
| Description: | late endosomal/lysosomal adaptor, MAPK and MTOR activator 1 [Source:HGNC Symbol;Acc:26068] |
| Percent Identity: | 57.32 % |
| Parental protein coverage: | 50.93 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | DPSSPPTKALNGAEPNYHSLPSTRTDEQALLSSILAKTASNIIDVSAADSQGMEQHEYMDRARQYSTRLA |
| DPSSPP.KA..GAEPN.HSLPS.RT..Q......LAKTA.NII..SA.DS.G.E..E.....RQY...L. | |
| Retrocopy | DPSSPPSKAPSGAEPN*HSLPSARTEQQGPVLLTLAKTAGNIIAESAVDSHGGE*QEDVGPPRQYGACLP |
| Parental | VLSSSLTHWKKL |
| .L.SSL.H.K.L | |
| Retrocopy | GLGSSLDHRKRL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 23 .99 RPM |
| SRP017611_kidney | 0 .00 RPM | 28 .75 RPM |
| SRP017611_liver | 0 .00 RPM | 12 .23 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010854 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000005788 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000010979 | 1 retrocopy | |
| Felis catus | ENSFCAG00000005320 | 2 retrocopies |
retro_fcat_142 , retro_fcat_496,
|
| Macropus eugenii | ENSMEUG00000003560 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000014117 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000010289 | 3 retrocopies | |
| Tarsius syrichta | ENSTSYG00000014730 | 2 retrocopies |