RetrogeneDB ID: | retro_fcat_1323 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
| Coordinates: | C2:16749110..16749348(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PFDN1 | ||
| Ensembl ID: | ENSFCAG00000001272 | ||
| Aliases: | None | ||
| Description: | prefoldin subunit 1 [Source:HGNC Symbol;Acc:8866] |
| Percent Identity: | 53.01 % |
| Parental protein coverage: | 66.39 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | KHAHLTDTEIMTLIDETNMYEGVGRMFILQSKEVIHNQLLEKQK-IAEEKIKELEQKKSYLERSV-KEAE |
| K..H........L....N.YEGVG.MF.LQ.KE.IHNQLLEKQK.I.E...K....KKSYLER.....AE | |
| Retrocopy | KRMHILQIRRLCLLNNSNVYEGVGEMFMLQTKEAIHNQLLEKQK<IEEQ-LKNWNRKKSYLERCL<VSAE |
| Parental | DNIREMLMARRAQ |
| DNI....MA..AQ | |
| Retrocopy | DNIWDVVMAPKAQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 19 .86 RPM |
| SRP017611_kidney | 0 .00 RPM | 21 .85 RPM |
| SRP017611_liver | 0 .00 RPM | 11 .52 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000005742 | 8 retrocopies | |
| Equus caballus | ENSECAG00000011843 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000019281 | 1 retrocopy | |
| Felis catus | ENSFCAG00000001272 | 1 retrocopy |
retro_fcat_1323 ,
|
| Macropus eugenii | ENSMEUG00000002726 | 3 retrocopies | |
| Microcebus murinus | ENSMICG00000000349 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000009432 | 4 retrocopies | |
| Otolemur garnettii | ENSOGAG00000003376 | 6 retrocopies | |
| Rattus norvegicus | ENSRNOG00000018653 | 1 retrocopy |