RetrogeneDB ID: | retro_etel_1445 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_267250:909..1156(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CCDC12 | ||
| Ensembl ID: | ENSETEG00000000030 | ||
| Aliases: | None | ||
| Description: | coiled-coil domain containing 12 [Source:HGNC Symbol;Acc:28332] |
| Percent Identity: | 55.29 % |
| Parental protein coverage: | 73.45 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | REKTGRKDKQEAEPKT-KQLREEEEEGEKHRELRLRNYVPEDEDLKRRRVPPAKPVAVEEKVKEQLEAAK |
| .E..G...K....PKT.K..REE.E...KHRELR....VPEDED.K.R.V..AKPV..EEKVKEQ....K | |
| Retrocopy | KE*PGQQNKEYRKPKT<KCFREEKEVCKKHRELRVWSSVPEDEDIKGRKVSQAKPVIEEEKVKEQQKGTK |
| Parental | PEP-VIEEVDLANLA |
| .EP..IEE.DLA..A | |
| Retrocopy | AEP<FIEEEDLATHA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000002280 | 3 retrocopies | |
| Dipodomys ordii | ENSDORG00000016567 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000000030 | 2 retrocopies |
retro_etel_1445 , retro_etel_2038,
|
| Homo sapiens | ENSG00000160799 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000019810 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000019659 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000006219 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000005086 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000013924 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000014862 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000003265 | 1 retrocopy |