RetrogeneDB ID: | retro_eeur_568 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | scaffold_346098:41291..41533(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MAGOH | ||
| Ensembl ID: | ENSEEUG00000015908 | ||
| Aliases: | None | ||
| Description: | mago-nashi homolog, proliferation-associated (Drosophila) [Source:HGNC Symbol;Acc:6815] |
| Percent Identity: | 67.86 % |
| Parental protein coverage: | 94.19 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 3 |
| Parental | ESDFYLR-YYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKND-VMIRKEAYVHK-SVMEELKRIIDDSE |
| .S.FYL.....GHK.KF.H.FLEFEF..D.KLRYA.NSNYKND...IRKEAYVHK.SVM..LKRII.D.. | |
| Retrocopy | QSHFYLC>NHMGHKRKFIHVFLEFEF*FDEKLRYATNSNYKND<LIIRKEAYVHK<SVMVDLKRIINDDN |
| Parental | ITKEDDALWPPPDR |
| ITKEDD.LWP...R | |
| Retrocopy | ITKEDDVLWPKIER |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 1 .13 RPM |
| SRP017611_kidney | 0 .00 RPM | 6 .00 RPM |
| SRP017611_liver | 0 .00 RPM | 1 .61 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009587 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000015908 | 6 retrocopies | |
| Felis catus | ENSFCAG00000025232 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000012778 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000012081 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000003849 | 3 retrocopies |