RetrogeneDB ID: | retro_eeur_148 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | scaffold_102830:3173..3368(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | FXYD4 | ||
| Ensembl ID: | ENSEEUG00000010030 | ||
| Aliases: | None | ||
| Description: | FXYD domain containing ion transport regulator 4 [Source:HGNC Symbol;Acc:4028] |
| Percent Identity: | 61.97 % |
| Parental protein coverage: | 95.95 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | LPALEADEATADESSPFYYDWETLQLAGTICAGVLCLVGIAFALSNKCKCKTKKEQSPVPESAIPFIVPG |
| LPALEA.E...DESSPFYYD.ETLQLAG.IC...L.....A.....KC..KTKKE.S..PE.A.PFI.PG | |
| Retrocopy | LPALEASESI-DESSPFYYD*ETLQLAGVIC---LVSIAFALSNKCKC--KTKKE*SLIPERAVPFIMPG |
| Parental | S |
| S | |
| Retrocopy | S |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 0 .64 RPM |
| SRP017611_kidney | 0 .00 RPM | 5 .06 RPM |
| SRP017611_liver | 0 .00 RPM | 0 .32 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000024923 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000017385 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000010030 | 4 retrocopies | |
| Felis catus | ENSFCAG00000022417 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000027578 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000006722 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000016033 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000014460 | 3 retrocopies |