RetrogeneDB ID: | retro_dnov_643 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_7159:21024..21241(-) | ||
| Located in intron of: | ENSDNOG00000010215 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | FXYD4 | ||
| Ensembl ID: | ENSDNOG00000017385 | ||
| Aliases: | None | ||
| Description: | FXYD domain containing ion transport regulator 4 [Source:HGNC Symbol;Acc:4028] |
| Percent Identity: | 59.21 % |
| Parental protein coverage: | 91.36 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | LPVLEANDLVADKHSPFYYDWESLQL-AGLICAGALCLIG-ILFTVYGKCKCKAKEKHSPLPEKPTPLIT |
| LP.LEA..LV.DKHS....D..SLQL.A.L.CA...CL.G.ILFTV..KC..KA..KHSPLPEK...LI. | |
| Retrocopy | LPALEASGLV-DKHSRL*SDRKSLQL<ALLVCAEITCLAG<ILFTVHDKCQRKARGKHSPLPEKAPLLIR |
| Parental | EGSASA |
| .GS..A | |
| Retrocopy | GGSSCA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 2 .33 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 0 .14 RPM |
| SRP012922_heart | 0 .00 RPM | 0 .00 RPM |
| SRP012922_kidney | 0 .00 RPM | 9 .04 RPM |
| SRP012922_liver | 0 .00 RPM | 0 .00 RPM |
| SRP012922_lung | 0 .00 RPM | 0 .15 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 0 .00 RPM |
| SRP012922_spleen | 0 .00 RPM | 0 .23 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000024923 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000017385 | 1 retrocopy |
retro_dnov_643 ,
|
| Erinaceus europaeus | ENSEEUG00000010030 | 4 retrocopies | |
| Felis catus | ENSFCAG00000022417 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000027578 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000006722 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000016033 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000014460 | 3 retrocopies |