RetrogeneDB ID: | retro_ecab_725 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
| Coordinates: | 3:69836628..69836787(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPS28 | ||
| Ensembl ID: | ENSECAG00000017256 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S28 [Source:HGNC Symbol;Acc:10418] |
| Percent Identity: | 71.7 % |
| Parental protein coverage: | 76.81 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MDTSRVQPIKLARVTKVLGRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREG |
| .DTS.VQ.IKLA.VTKVLGRTGSQ.Q.TQ...EFMD.TS.SII.NVKGP...G | |
| Retrocopy | IDTSCVQLIKLAWVTKVLGRTGSQEQHTQAPMEFMDNTSFSIICNVKGPMSKG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 473 .24 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 276 .28 RPM |
| SRP021940_embryo | 0 .00 RPM | 496 .88 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 281 .93 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 465 .23 RPM |
| SRP021940_testis | 0 .00 RPM | 287 .11 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000004917 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000002468 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000022876 | 5 retrocopies | |
| Equus caballus | ENSECAG00000017256 | 1 retrocopy |
retro_ecab_725 ,
|
| Loxodonta africana | ENSLAFG00000029923 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000023621 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000028895 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000003890 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000067288 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000042886 | 2 retrocopies |